PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.06G059600.1.p
Common NameGLYMA_06G059600, LOC100804201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 311aa    MW: 33958.1 Da    PI: 7.6416
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.06G059600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.71.2e-08443437
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                         + C+ +++  ++l+C+ +  +lC  C ++ H        H
  Glyma.06G059600.1.p  4 KLCDSCKSATATLYCRPDAAFLCGACDSKVHAAnklasrH 43
                         68***************************99555555556 PP

2zf-B_box23.21.4e-074791442
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                           C+ +e+ +++  C+ +   lC  C   +H+       H+++p+
  Glyma.06G059600.1.p 47 VLCEVCEQAPAHVTCKADAAALCLACDRDIHSAnplasrHERIPV 91
                         68*****************************66899999998885 PP

3CCT70.63.9e-24253296144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Glyma.06G059600.1.p 253 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 296
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.424148IPR000315B-box-type zinc finger
SMARTSM003362.0E-13148IPR000315B-box-type zinc finger
PfamPF006435.5E-7445IPR000315B-box-type zinc finger
CDDcd000211.64E-8546No hitNo description
PROSITE profilePS5011910.7514491IPR000315B-box-type zinc finger
PfamPF006433.4E-64791IPR000315B-box-type zinc finger
SMARTSM003362.4E-94991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787253295IPR010402CCT domain
PfamPF062034.4E-18253295IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MASKLCDSCK SATATLYCRP DAAFLCGACD SKVHAANKLA SRHPRVVLCE VCEQAPAHVT  60
CKADAAALCL ACDRDIHSAN PLASRHERIP VTPFFESVHS VKASSPINFH HRFFSDADAD  120
ADVSTEEAEA ASWLLPNPKT DLNSSQYLFS ETEPVPYIDL DYAAMDPKTE QKSSATADGV  180
VPVQSNFEPF TYGYKYNTTL SQSQSHMSQS VSSPSSMEVG VVPDGNTMSE ISNCSYSKVA  240
PVTVTAQFSA ADREARVLRY REKRKNRKFE KTIRYASRKA YAETRPRIKG RFAKRTDADP  300
LAGYGVVPSC *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.168570.0cotyledon| epicotyl| flower| hypocotyl| leaf| pod| root| seed coat| somatic embryo| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0933000.0BT093300.1 Soybean clone JCVI-FLGm-17I7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526113.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-112COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A0R4J3G90.0A0A0R4J3G9_SOYBN; Uncharacterized protein
STRINGGLYMA06G06300.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-96CONSTANS-like 4